PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr031682.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 323aa    MW: 36556.5 Da    PI: 6.694
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr031682.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.1e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed+ l +++k++G g+W+  +++ g++R++k+c++rw++yl
      Pbr031682.1 14 RGAWTAHEDKVLTQYIKLHGEGRWRNLPKKAGLKRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding53.17.2e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ +++E+el+++++k+lG++ W++Ia +++ gRt++++k++w++ 
      Pbr031682.1  67 RGNISPDEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 111
                      7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.972961IPR017930Myb domain
SuperFamilySSF466892.97E-2812108IPR009057Homeodomain-like
SMARTSM007173.9E-131363IPR001005SANT/Myb domain
PfamPF002491.3E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-231568IPR009057Homeodomain-like
CDDcd001673.51E-101661No hitNo description
PROSITE profilePS5129425.4262116IPR017930Myb domain
SMARTSM007175.3E-1666114IPR001005SANT/Myb domain
PfamPF002494.4E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2469116IPR009057Homeodomain-like
CDDcd001673.26E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGRSPCCAKE GLNRGAWTAH EDKVLTQYIK LHGEGRWRNL PKKAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI SPDEEELIIR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNT NLGKKVHDQQ  120
QQRSASNLKH HKNGEPNSKN AKSTDMASPS SLVYRTKAAK CTQVFINPQP HKVLLGHDHQ  180
HCTEETNTVL MFDDKPAAMD DDHINRALSF SSFSNINADQ ENSTSDFLVD FDIASLLNSD  240
FPEINHDYLN HNHSDNITSH FVDETAQFFS EEMLQHWNNG GSDDGDDQVQ VQPNLALNFH  300
SFTSFLGSDH QGEEWLGVGE SS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009340433.10.0PREDICTED: transcription factor MYB32-like
TrEMBLM5WG391e-157M5WG39_PRUPE; Uncharacterized protein
STRINGGLYMA13G16890.12e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.14e-63MYB family protein